Describing Wordsfor Food

examples: nose,  winter,  blue eyes,  woman

Here are some adjectives for food: plentiful free, chemically nutritious, always soft and tacky, food--real, foreign, soft, unpalatable and insufficient, frugal but nutritious, little or too bad, fresh, high-quality, wretched and insufficient, dangerous and unsubstantial, ]oriental, own computer-controlled, excellent and highly nutritious, cold and insufficient, fresh and palatable, abundant and better-prepared, spare adequate, real and tasty, unwholesome and insufficient, heavenly incorruptible, wholesome and abundant, tasty, nutritious, chronically meager, organic and especially animal, nutritious but real, palatable but hot, improper and insufficient, supply dainty, lusty and masculine. You can get the definitions of these food adjectives by clicking on them. You might also like some words related to food (and find more here).

Sort By Usage Frequency

Click words for definitions.

Words to Describe food

Below is a list of describing words for food. You can sort the descriptive words by uniqueness or commonness using the button above. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for most common nouns. Here's the list of words that can be used to describe food:

plentiful free chemically nutritious always soft and tacky food--real foreign, soft unpalatable and insufficient frugal but nutritious little or too bad fresh, high-quality wretched and insufficient dangerous and unsubstantial ]oriental own computer-controlled excellent and highly nutritious cold and insufficient fresh and palatable abundant and better-prepared spare adequate real and tasty unwholesome and insufficient heavenly incorruptible wholesome and abundant
describing words continue after advertisement
tasty, nutritious chronically meager organic and especially animal nutritious but real palatable but hot improper and insufficient supply dainty lusty and masculine enough good and wholesome rich plentiful delectable aromatic good and juicy bland african wholesome and plentiful proper, healthful gaunt but good sure warm dehydrated and canned coarse and wretched indigestible and misguided insufficient and unwholesome lawful and acceptable gross and savory suitable bacterial insufficient, unwholesome just mexican simple and nutritious excellent exotic arid black-market ordinary and wholesome unclean or unnatural unaccustomed coarse indeed wretched and insufficient doctrinally permissible prime and proper bad and insufficient proper and allowable insufficient and bad wholesome and elegant unfailing and practically inexhaustible dry and indifferent insufficient and unhealthy digestible and nutritious miserable, insufficient supply sufficient and proper preferred sedentary improper or insufficient proper artificial scanty and unwholesome human commercial theoretically sufficient supposedly imperfect virtually ongoing preferred canned insufficiently fresh chief and most substantial indigenous but apparently deficient earliest and most intensive simple, northern unaccustomed spicy supply cheap and tasteless good, well-served special airborne inexpensive, good unadulterated and wholesome delicious real least, estimable solid, wholesome scanty, unwholesome aside animal themselves--intellectual sufficient wholesome enough nutritious material and cheap poor and insufficient portable ready-made wholesome, appetizing coarse but wholesome much or unsuitable bulky and solid coarse and insufficient wholesome, digestible substantial and nutritious coarse and unpalatable undigested mental stronger poetical coarse, distasteful simply unwholesome strong and nutritious unadulterated animal abundant and readily available pure, digestible juicy nutritious fine mysterious dry but wholesome scant, unwholesome hot and piquant national manufactured abundant eatable delicate and suitable scarce and wrong wholesome and sober supply energy-producing rather high-protein insufficient or improper sufficient healthy expensive canned cold, synthetic much and too rich abundant and wholesome wholesome, nutritious rough and paltry leftover chinese hot, unrecognizable clean, well-prepared quiet and hot best daytime chemically correct unfamiliar but chemically correct available and totally vulnerable irregular and improper expensive and unwholesome desperately meager hot, high-energy abundant immediate coarse nor fine now stale or old quickly warm highly nutritional vile and insufficient authentic-real chinese wholesome ukrainian usually lukewarm and bland usually lukewarm real and synthetic tasty invalid deplorably indifferent absolute finest indigestibly spicy improper and unwholesome well-balanced, nutritious surely fitting salty or fat much starchy seasoned and rich highly seasoned and rich unwholesome and poisonous cheaper and healthful correspondingly scarcer and poorer correspondingly scarcer wholesome digestible coarse and regular sterile liquid delicious and merciful least nutritive recently would-be other cheapest cheap bulky wholesome necessary unwholesome or insufficient proper, assimilable extremely spanish invariably improper wholesome solid substantial true together abundant tasteless and unpalatable scant and nauseous sour and flatulent indigestible and unwholesome new and luscious much or improper delectable and luscious plentiful and best nutritious and artificial exactly hearty rich and unclean cheap, unwholesome sweet sacrificial judicious, wholesome additional suitable clean sacrificial rich or highly seasoned fat or animal nutritious and suitable principal javanese bitter and insipid savory and most delicious attractive, abundant good, appetizing raw and ill-prepared absolutely cheaper strongly seasoned solid indigestible indigestible or noxious tough and indigestible nutritious and appropriate animal and delectable pure respiratory wholesome plain permanently high-priced delicious belgian other and wholesome insufficient and unsuitable nutritive and restorative highly nutritive and restorative generous but digestible coarse or insufficient sufficient nor proper appetizing well-served scanty, watery natural and most usual good, nutritious good and nutritious bad or insufficient wholesome and nutritious wholesome and sufficient free alien fresh and tempting truly cheap rural italian bad, insufficient raw, greasy complex and exact high-protein dehydrated wholesome, solid plain and abundant loathsome and abhorrent commodities--international insufficient or unsuitable such dyspeptic simple, nutritious delicate liquid richer spiritual thine ordinary plain, nutritious much animal much nutritious plain, wholesome tasty, hot fresh, colorful significant good volcanic bottled enough canned and dry addstional special, tasty occasionally extra occasional marvelous dull, high-fiber cold chinese delicious vietnamese ongoing dependable mostly practical doubtless irresistible forlorn, leftover lean animal apparently deficient crystal, tasty starchy czech brightly colored but stupid vastly productive strange, bland fanciest chinese real austrian dry, inedible pleasant and most healthful still good and cold authentic portuguese predictably excellent sure chinese yummy irish cold but good requests-special unusual requests-special little and too wretched genuine vietnamese surprisingly edible unidentifiable but pleasant unopened soft good nutritious heady exuberant cially fine foul good pure, sanitary vile canned certainly good and eatable delicious, expensive essential terrestrial unutterably delightful cheap fatty human edible fine and heady strictly cold insufficient, unnatural perpetually reusable deliberately insufficient less or poorer cheapest and most compact much, substantial warm and satisfying plain digestible unusual or different hard or animal unwholesome native supply delightful supply animal oily animal fat or oily animal poisonous intellectual delicate and extremely rich mild wholesome nutritive and agreeable poisonously bad dry, starchy supposedly injurious good, wholesome and nutritious soft and digestible pleasant delicate imperfectly canned seasoned and irritating highly seasoned and irritating nutritious and favorite filthy or improper improper or unwholesome palatable or nutritive nutritious and healthful sometimes man-made bad and deficient healthful, simple rarer spiritual cheap and proper spare and tasteless natural and most proper succulent or savory particularly succulent or savory ther national wholesome and pure down plain and wholesome purest and most nutritious palpably wholesome abundant and most general delicious plain fairly sanitary coarse and unwholesome sure-enough human scarce green heavy, starchy fresh and appetizing savage but still simple solid or crisp extraordinarily interesting and amusing divine and unfailing lightest portable barest, hardest nutritious, warm durtal substantial real edible chief liquid principal nutritious wholesome and not unpleasant excellent nutritious simple vegetarian fibrous, bulky and solid however good and abundant adequate and stable rich and indigestible imperfect or improper disastrous, perfect heavy, hearty fresher, better lowest-cost nutritive and excellent solid sacrificial especially laudable and superior especially laudable plentiful and plain nice appetizing doubtless tempting unripe, objectionable likely sour coarse, meaty away starchy good, savory and appetizing real gaseous dry, economical insufficient and poor always ample and excellent fried or greasy scant plain part--spiritual better part--spiritual moist, watery economical, palatable ideal starchy insufficient and very poor natural and inexpensive stronger, larger and better wrong or unsuitable much carrion favorite and most common sweetest literary exciting and elegant indigestible mental favorite larval appropriate larval cold and indigestible locally abundant and cheap locally abundant indifferent and insufficient hot abundant sweet and poetical physiologically economical imperfect, unbalanced valuable and most economical insufficient and indigestible rotten or poisonous more energy-producing delicious, nutritious and healthful rough but welcome improper or defective unwholesome and uninviting adequate and wholesome balanced or perfect simplest medicinal unaccustomed green lightest and most agreeable scanty, unpalatable bitter, half-digested digestible single poisonous or very irritating nutritious and very pleasant much, less sacred or sacramental nutritious and condensed highly nutritious and condensed hope--mental forlorn hope--mental comparatively edible impure and pure tasteless, gelatin-like digestible, nutritious dairy-animal material, cheaper adaptable, ever-changing exceedingly digestible unwholesome cheap disgusting, unnatural unsuitable and improper chemically richer therefore starchy unsuitable or too rich palatable and substantial rich, fateful ceremonially impure necessary, free usual sole peculiar and very delicious good, sweet and wholesome succulent or watery wholesome, moist uniformly succulent and nutritious uniformly succulent adequate and pleasant healthy, nutritious wholesome and exceedingly nutritious regular and nutritious suitable and well-prepared many undecorated tough, unpalatable sweet, unwholesome nutritious liquid scanty, sticky cheapest liquid particular, well-known succulent or most nutritive indigestible intellectual plain, digestible liberal weekly abundant and cheaper more abundant and cheaper clean and tasty sufficient but not excessive nutritious and easily digestible better soft fatty or starchy good condimental precious but indigestible often unpalatable improper or indigestible own palatable savory exotic rotten or insufficient merely stored-up daily clean and good undigested foul-smelling generally nutritive delicious succulent associate interesting suitable nutritious suitable and nutritious nourishing and digestible coarse but highly acceptable poor and injurious coarse but hearty exclusively solid solid, undigested insufficient and often unwholesome bad and very scanty sufficient animal sufficient nutritious also scanty warm, plain palatable and welcome expensive ready-made much but hearty insufficient and unfit nutritious, acceptable miserable intellectual good but very plain large-scale international unwholesome animal evidently firmer expensive, rotten soft innocuous seasoned or greasy highly seasoned or greasy wholesome and other coarse and unsavory wholesome and well-dressed hungry, wholesome and well-dressed wholesome dry soft, nutritious inferior and insufficient fat animal poor and wholesome nutritive and very digestible exciting and poisonous rich wholesome irritating or indigestible starchy and fat sweetest and most savory welcome green hard or solid best but cheapest worst and humblest heavy, coarse and indigestible coarse and indigestible healthful, nutritious simple, natural and healthful relatively indigestible much stodgy unwholesome and unsuitable own nectareous simple but very excellent particular fungal solid and perhaps indigestible improper, unwholesome miraculous chemical unwholesome or meager nutritious, digestible unsalted, animal always acceptable and beneficial abundant wholesome quantitatively inadequate coarse delicious valuable and comparatively inexpensive substantial, inexpensive least unwholesome nutritious and savory evidently abundant beastly heathen bake sufficient bulky, coarse mild, succulent agreeable, succulent probably lawful coarse, unwholesome acceptable but desirable scant and rancid admirable and savory acceptable and valuable picturesque and highly desirable strictly indispensable scanty and other supply wholesome and plentiful generally unpleasant and acrid acceptable and nutritious wholesome, acceptable and nutritious gross, inflammatory good or luxurious simple nutritious wonderful and succulent heavy sticky harsh or sour fresh civilized decayed seal uncertain and often inadequate weary refreshing unattractive, unsatisfying away succulent and delicate certainly--intellectual obviously indigestible bad and hot spiced and richer especially rich and spiced difficultly digestible rich or difficultly digestible fatty and abundant delicious nor wholesome sufficient or nutritious coarse or poor coarse, frugal edible and delicious hard or indigestible irritating and indigestible least, eatable sufficient and comfortable raw and unprepared unaccustomed animal palatable and not unsatisfying possibly warm milky, healthful equally good and nutritious newest prodigal little or poor primitive and unpalatable wholesome and delicate little, solid fat and spicy sour, fat and spicy former customary always abundant and good national and necessary indigestible and unsuitable intrinsically wholesome nutritious, dry sufficient succulent green or soft insufficient and rotten plentiful and frequent scanty, insufficient sometimes useful and beneficial refreshing and moderate harmless and most excellent adequate and easily available insipid and loathsome rich elemental sweeter and stronger solid and plain material and undigested slight, wholesome insufficient and unsound nourishing and abundant moderate, animal unhealthy, undigested natural, lawful forth moody sanitary, healthful hot, wholesome simple and too nutritious much dehydrated aside ample new unpalatable necessary european rather perishable rotten or bad particularly bad and scarce previously scarce wholesome, valuable other high-protein especially agreeable such middling stale monotonous abundant and legitimate tolerably nutritious appetizing and healthful highly starchy poor and unsavory improper or too abundant tough and coarse solid and animal doubtfully healthful <cd>animal principal, animal nutritious daily mental particular favorite healthful and palatable abundant and nutritious daily intellectual supply wholesome hot, solid plain but wholesome unaccustomed good limited indigenous spare good healthiest single important and abundant nenbutal much rich strange, good decently spiced initial two-year good balanced richly bad oversized alien profitable, diversified bland and healthful different and succulent good, greasy nutritious and digestible wholesome and regular nauseous and unwholesome rude, portable heavy, tasteless rich edible coarse and plain healthy and abundant hot or irritating nutritious animal sufficient and appropriate material, natural fat and sweet wholesome but unattractive ordinary, coarse wretched and scanty coarse indigestible impoverished or indigestible raw, sweet least coarse refreshing, nutritious good and abundant admittedly excellent less nutritive awful french condimental standard simple therefore lower decent chinese tasty black fine ethnic badly fried sufficient coarse nutritious and agreeable quite palatable recent pure starchy or sugary delicate and nutritious healthful and nutritious refreshing and healthful earliest intellectual more egotistic horribly revolting nutritious and satisfying highly nutritious chief animal massive international quite compatible damned empty public spiritual clean or unclean special supplemental excellent free enough good wholesome mental less animal thy scanty fresh and abundant bigger potential fresh animal always soft especially animal good and appropriate more nutritious less nutritious nourishing least hot annoyingly wholesome canned and dry actual substantial adds\-tional readily expandable nutritious, corny nutritious, compact essentially portable spiced, mediocre grossly appalling purely survival fresh canned normally unavailable suspiciously spicy sporadically cheap liquid, little bloody, half-digested expensive, high-quality boring and tasteless excellent vegetarian working-class ethnic barely seasoned satisfying durable unpacked delectable sufficient ready familiar, homemade plentiful hearty inexpensive, wholesome still hospital decent solid adequate but plain buttery european little edible rich solid institu\-tional unaccustomed rich polish, german and swedish complex mexican ly cold ently deficient average less hungry and good cally meager bad but plentiful colored but stupid nutritious, appetizing tasty stupid vulnerable and extensive seemingly vulnerable and extensive down oversized in-house subsidized routine, hospital repulsively plain spiced mexican always delicious and plentiful untouched chinese plain and very healthy bland, safe stale, institutional rich and unusual cheap and tasteless coal and free straightforward, wholesome australian-based multinational overgenerous, heavy back chinese chinese or italian first-rate mexican cloying but good wholesome carnival simple but delicious fresh and canned greasy tasty for�unusual exotically spiced wholesome, restorative substantially intact plain healthy half-empty chinese tasteless rubbery unusual and ethnic chemically exotic thin invalid local mega warm and only such sanual expensive and good dense but good-hearted rubbish--real fresh and stale spectacularly messy long-keeping fresh sufficient or even excess cold, undigested lavish, rich authentic cuban just chinese acceptable healthy fatteningly good and hard fatteningly good strong, cheap ritually unclean single, natural unredeemably wretched partially undigested spiced and extremely hot stationary and portable low-fat, tasteless good legion creditable, affectionate glum healthy grim festal unusually dry and tasteless ample but safe ngly meager real, pure supply tasty chinese or mexican cold but appetizing richly oiled indifferent chinese precious, familiar good and eatable indeed wretched rich, intellectual viciously expensive viciously expensive but superb boring local plain seasoned nearby and delicious appropriate canine supply high-protein rich and uncomplicated good, rich and uncomplicated fast chinese simultaneously appalling and satisfying simultaneously appalling sappy aromatic reasonably well-prepared intriguing, delicious bland, heavy hot, cheap bland or spicy succulent canned fancy tepid fresh, vulnerable much jamaican never alien enough dehydrated metal, rotten same crummy greasy human dusty canned pricey organic sparse but adequate underpriced, mediocre horrible, indigestible incredibly unhealthy exceptional hospital forever reusable good, starchy usual, stale foamy, soft glaringly anachronistic mexican and german fresh nutritious food—real exciting, intellectual particular electrical nutritious, excellent billy extra normal wholesome last basic already precious delicious and savory mildly nutritious improper and unsuitable more eatable cold, indigestible luscious and nutritious therein boundless sumptuous and dainty artificial one-sided meanwhile bad coarse mortal stronger, harder good valuable clean, delicious oatmeal comparative fatter and better stale and wretched unexpected and solid warm, wholesome hardly orthodox coal and better hospital spare ready and wholesome false and unhealthy coarse, disgusting solid nutritive sweet and cheap

Popular Searches

deathdarkdaddolphinsdesertdepressiondelicious fooddinosaurseyesenglishemotionseasterearthexcitedearthquakeelephanteventsessaysfriendsforestfamilyfunfeelingsformflowersfeargoodgrassguysgodgreengoldgeographygirlfriendhairhothappyhandshatehomeheathorriblehardice creaminstrumentsiceinterviewinsectsindiaislandimaginationimageryjoyjesusjellyjazz musicjunglejobjealousyjewelryknifekindkitchenkittenskingkissingknightslinelightlipslightningloudlaughlandscapeslionslifemusicmountainsmacbethmoviesmaterialsmoodmelodymalesmeadowmonstersnarrativesnicenightnervousnaturenoisenamesnosenounsnursesoldobjectsoceanorange

Words to Describe food

As you've probably noticed, adjectives for "food" are listed above. According to the algorithm that drives this website, the top 5 adjectives for "food" are: plentiful free, chemically nutritious, always soft and tacky, food--real, and foreign, soft. There are 995 other words to describe food listed above. Hopefully the above generated list of words to describe food suits your needs.

If you're getting strange results, it may be that your query isn't quite in the right format. The search box should be a simple word or phrase, like "tiger" or "blue eyes". A search for words to describe "people who have blue eyes" will likely return zero results. So if you're not getting ideal results, check that your search term, "food" isn't confusing the engine in this manner.

Note also that if there aren't many food adjectives, or if there are none at all, it could be that your search term has an abiguous part-of-speech. For example, the word "blue" can be an noun and an adjective. This confuses the engine and so you might not get many adjectives describing it. I may look into fixing this in the future. You might also be wondering: What type of word is food?

Describing Words

The idea for the Describing Words engine came when I was building the engine for Related Words (it's like a thesaurus, but gives you a much broader set of related words, rather than just synonyms). While playing around with word vectors and the "HasProperty" API of conceptnet, I had a bit of fun trying to get the adjectives which commonly describe a word. Eventually I realised that there's a much better way of doing this: parse books!

Project Gutenberg was the initial corpus, but the parser got greedier and greedier and I ended up feeding it somewhere around 100 gigabytes of text files - mostly fiction, including many contemporary works. The parser simply looks through each book and pulls out the various descriptions of nouns.

Hopefully it's more than just a novelty and some people will actually find it useful for their writing and brainstorming, but one neat little thing to try is to compare two nouns which are similar, but different in some significant way - for example, gender is interesting: "woman" versus "man" and "boy" versus "girl". On an inital quick analysis it seems that authors of fiction are at least 4x more likely to describe women (as opposed to men) with beauty-related terms (regarding their weight, features and general attractiveness). In fact, "beautiful" is possibly the most widely used adjective for women in all of the world's literature, which is quite in line with the general unidimensional representation of women in many other media forms. If anyone wants to do further research into this, let me know and I can give you a lot more data (for example, there are about 25000 different entries for "woman" - too many to show here).

The blueness of the results represents their relative frequency. You can hover over an item for a second and the frequency score should pop up. The "uniqueness" sorting is default, and thanks to my Complicated Algorithm™, it orders them by the adjectives' uniqueness to that particular noun relative to other nouns (it's actually pretty simple). As you'd expect, you can click the "Sort By Usage Frequency" button to adjectives by their usage frequency for that noun.

Special thanks to the contributors of the open-source mongodb which was used in this project.

Please note that Describing Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

expedientlyarcellidaeeszettkidnappedfeldmeilenkoalamusculosomattagestadakatsukitcheemesodapedonshardauklandshamnterrorismitirapinaenlightenedperseverancenairoviridaeboistdumbasssemirahmpaemotionmuchinguriblossommultitaperscavullohimojansaelginerpetonalcoholicsdotbusterseurythermtilgunghereticallyverardmerostachyscanciohowlingnijeveenprisonniershemotoxicretroislandersteeleprocessorquintuplingchaoboridaesusrecrystallizeinterpolantscalphunterectopocynusinstallshieldloydemisteachingcreatubonvinosharpshooterimpuritieswhodunitscheckoingtabitudeintellectionladakhlisherstouhyglancingsastutenessdisintermediatemoldovanbelfothunderstormsamargasappreciatecarabaoworkaholicsmidsectionnorfenfluraminegaetaphragmoteuthidapoikilothermousacquasantieresinisterprivatierbathedstimulushighestoccupiedmolecularorbitalhemochorialopenwindowsbuilderarimaddanalatinisestarfacekwkhplagianthusoppressoreutychesinfracturwsokumvatnetdometictemperedhryvnassimmarasihummedtraumadiatribecalcifediolekkehardtreeplausiblenessfeastclaregigantothermyhabitatsthaiblivetsallahcherlyprestrictionfeetmodiuscollaboratorperiwinklechairboduppalmagnetotelephonecapillarebodgeddiscusschamouxstordahlbroshopianmoebiteleakingarchaeologycharactercanadaspididamoeilijkerjubileeiprimusmoelmudnightcambernonjumonjicarvingsmoelvreramiaconciergeandroidtvmuncycvcmansioncoredamagedsoccerlitteraturchocadadoormoggieeuarctoshanrattyimportantjailsmogheirajirkovskishairdressermogsbessheimabchatorahnondepressedmoguebusserobremebootscountrifiedimpennatenosedabkehwomenafterthoughtsanievasclassmatemohursglancedstrikemoiramaberhosonointerpetalarywellfleetadultsaltinhotitelmannabymeautocraticoutricide