Describing Wordsfor The poison

examples: nose,  winter,  blue eyes,  woman

Here are some adjectives for the poison: wretched mineral, null real, fearful morbid, secret and destructive, potent and unequivocal, subtle and very violent, invisible, overpowering, black, sappy, invisible, pernicious, violent corrosive, sweet, exasperated, secret antidotal, slow, terminal, charming, potent, excellent selective, general protoplasmic, clear and tasteless, deadly powdered, subtle and little-known, grey corrosive, black, numbing, fierce, vigorous, enough slow, potent, transparent, still virulent, innate mortal, quickly operative, worse nor slow, narcotic acrid, deadly mineral. You can get the definitions of these the poison adjectives by clicking on them. You might also like some words related to the poison (and find more here).

Sort By Usage Frequency

Click words for definitions.

Words to Describe the poison

Below is a list of describing words for the poison. You can sort the descriptive words by uniqueness or commonness using the button above. Sorry if there's a few unusual suggestions! The algorithm isn't perfect, but it does a pretty good job for most common nouns. Here's the list of words that can be used to describe the poison:

wretched mineral null real fearful morbid secret and destructive potent and unequivocal subtle and very violent invisible, overpowering black, sappy invisible, pernicious violent corrosive sweet, exasperated secret antidotal slow, terminal charming, potent excellent selective general protoplasmic clear and tasteless deadly powdered subtle and little-known grey corrosive black, numbing fierce, vigorous enough slow potent, transparent
describing words continue after advertisement
still virulent innate mortal quickly operative worse nor slow narcotic acrid deadly mineral energetic and fearful violent caustic violent narcotic deadly moral extremely corrosive astonishingly active palatable and caustic discreetly ephemeral glaring pure lethal and little-known familiar mellifluous subtle perfumed airborne fast-acting acrid narcotic subtle sudden slow slimy direct narcotic narcotic and depressing fresh and virulent stealthy narcotic subtle and terrific enough alcoholic violent septic violent malignant specific venereal rancorous, mortal violently corrosive energetic, narcotic vicious and unheard-of subtle, fatal swift, far-flung crudely blended contributions_--fatal fatal and extraordinary sensuous erotic agonizing fatal latest and undetectable bitter and subtle irritating and narcotic deadly corrective quick and deadly corrective tenacious and hardest good, efficacious swift but painless penetrating icy subtle instantaneous extraordinary socialistic diffuse liquid sweet but insidious deleterious and invisible narcotic or acrid typical respiratory bitter and corrosive irritating narcotic standard insecticidal swift specific primordial ethical maddening mental slow and secret risky and undesirable stinging, numbing deadliest martial new and little-known well-known and ancient tough, clammy definite and well-developed slow corrosive nitro-aerial slow-acting deadliest italian painful and incapacitating subtle but certain lusty strong powerful narcotic ymical bacte\-rial bacte�rial wily tough lethal, fast-acting strong but subtle vile crimson green corrosive purest, blackest ly pure horribly sweet sophisticated residual worst virulent swift, harsh final but equally effective slow-acting but extremely efficacious potent and fast-acting obscure and unidentifiable asian herbal fiendish narcotic deadly nerve-shattering villainous racial deadliest natural slow-acting and undetectable destructive, corrosive true genocidal subtle, chalky mysterious non-lethal insidious and beautiful yellow foamy lethal neurotoxic stale, certain subtle, numbing thereby fresh regular entomological certain corrosive exceedingly harmful powerful and very painful powerful, corrosive peculiar contagious terribly virulent acrid, narcotic secret and most subtle strong subtle subtle, unknown subtle and rapid hospital, black subtle and fatal insidious and subtle unusually subtle “cerebro-spinal germinal or fetal unknown neurotic common narcotic powerful, narcotic fierce and subtle subtle and intoxicating seductive moral fragrant slow subtle and quick scarlatinal slow and subtle neurotoxic strong narcotic gay and delicate noxious white active narcotic powerful corrosive obsolete military especially potent blue beautiful previously incurable swift italian slow seductive thy sugared virulent and fatal now significant powerful liquid slow but infallible powerful caustic quick, painless more venomous strange terrible just male noxious new bright evil explosive grotesque slow, painless extremely efficacious rapidly lethal insidious slow highly acrid thy gentler energetic cardiac bitter moral subtle and singular singular animal unknown and subtle powerful neurotic vile filthy virulent fast-acting subtle and potent cold, dense thick, pasty delicate, voluptuous strong intoxicating narcotic subtle oriental useful and effective rapidly fatal effective biological utterly pure exquisite and subtle quiet slow terribly rapid sweet and penetrating specific morbid seductively sweet finest, strongest terrible and swift safe and effective al good particular favorite gradual and insidious rapid and fatal mineral or animal subtle, insidious hot, foul thy sleepy peculiar and subtle ordinary off-the-shelf powerful, evil subtle slow more mute wyval free, black strong corrosive deep delicious slow but fatal definite and peculiar hypodermal swift and rapid rare and powerful highly lethal corrosive extremely virulent black and dangerous hamal foul and horrible sweet intoxicating sure and rapid now popular old terrestrial just drunk long-acting movable and immovable strange chinese own loathsome quick and penetrating easily obtainable violent spiritual quick painless low-calorie slow persistent other slow insecticidal truly dreadful cruel and dangerous famous secret dear, delicious slow, subtle fairly potent terrible slow raw, bitter white opaque antidotal still pure adrial integumental thy subtle deadliest fatal spiritual wonderful secret gouty and rheumatic strong and dangerous sure and speedy safe, quiet unabsorbed arsenical pestilential much slow more insidious quick and certain highly potent bactericidal such prodigious subtle feminine ordeal subdermal slow black fairly rapid swift and subtle slow and sluggish sufficiently active more mortal swift, subtle deadly green such lethal thick syrupy slow, sure just sweet same potent insidious slow but certain slow internal swift and fatal strong and subtle least moral usual green subtle little effective hydrophobic certain slow sweet and subtle particularly loathsome least painful such insidious slow but sure venereal cold, sweet slow pure, undiluted other synthetic slow and sure subtle spiritual sweet, sweet rankest septic other effective terribly exciting more virulent such subtle slow and gentle same organic own dire highly active other metallic other morbid puerperal atmospherical same subtle moral or intellectual highly toxic much bitter own unpleasant bitter white yellowish brown new special brave, beautiful seven-day incapacitating cumulative strong animal exceedingly strong new organic potent purely military catalytic particularly nasty non-lethal dangerous political extremely violent strange and subtle little-understood gonorrheal such unmistakable extremely painful deleterious cerebro-spinal swift and sure bitter, bitter bitter sweet residual stupefying acrid certain dangerous peculiar and characteristic pale amber drunk infectious much rarer cardiovascular contagious fatal such political more gradual more green enormously powerful numbing painless alcoholic more hideous particularly effective still full little-known same powerful liquid black-tipped mortal sugared longer-term metabolic morbid tubercular specific much secret mineral undiluted equally effective slow and heavy new and interesting lethal bacterial selective enzymatic systemic venomous wicked, wicked protoplasmic genocidal own specific palatable surest microbial same fatal totally distinct deep and subtle other subtle alkaline sappy swiftest equally powerful inorganic intoxicating high-velocity noxious baneful obtainable more subtle milky white nauseous doped same mad cancerous toxic soluble mighty bad infinitely less little cold mercurial almost pure damn sure rial little fresh “real own damn violent more productive undetectable secret two-part latent almost unknown heady nerve-shattering sweet needle-sharp livid new scientific active same moral deadly such bitter rather strong several famous twelve-hour moral rarer unequivocal pernicious off-the-shelf diabolical malignant rheumatic caustic more active always more or less binary always more javanese more substantial delicious penetrating swift powerful more fatal viral illuminating chemical pure destructive milky radioactive racial seductive such mental low-grade entomological bitter pestilent maddening loathsome causative iced parasitical worse other suitable oral irremediable chauvinistic fiery after-dinner colorless cryptic such pleasant more dangerous lethargic dangerous sibilant vile nastier neurotic electrochemical foulest tasteless fairly common gaseous greenish agonizing moral and political stinging well-developed corrective blackest volatile herbal efficacious foul infallible kal dulcet strongest mellifluous fetal cold black serpentine brackish intellectual and moral stringy somatic strong bottled pleasing extremely powerful overhead purest scented devilish rancorous organic indisputable germinal more civilized prodigious invisible central asian psychic different coloured carnivorous much worse irritating angelic clammy addictive sheer pent-up euphoric robotic respiratory preservative absolute flattering biologic tempting cellular frightful yellow-green debilitating nasty old quickest unsuspected airborne old familiar endemic atmospheric pasty avian effectual instantaneous artificial voluptuous subtler rapid gouty speedy terrible effective calamitous sizzling ill-gotten sulfurous scathing sugary aqueous sure digestive undetected enough rare own peculiar particular impervious exasperated neural baleful gentle animal operative nasty pale-blue sweetest straightforward truant mutinous longed-for abstracted electoral insipid risky favorite overpowering almost perfect mild pure and simple extraneous stealthy filthy wordy thorny cold infernal cruel unseasonable fearful signal quite sure spiritual dreadful marxist undetermined ecstatic magical flaming mental more powerful all-pervading more immediate telltale unknown congratulatory incurable gentler energetic inflammatory syrupy unnatural powdery quick evil portable thick black horrible metallic indigestible immodest sickening melodious more potent drastic socialistic sleepy other good topical blissful murderous nagging congenital detectable hateful vicious sweeter heretical industrial hideous intellectual hallucinatory etruscan captivating malign mightiest worst anonymous scarlet biological irreplaceable sectarian chaotic horrid far-flung harmful invincible chronic blinding movable environmental superstitious glandular precious powdered amber nice little all-purpose hitherto unknown sceptical parasitic stronger low-lying actual opaque political superfluous tactile exhilarating undesirable dual little more enchanting aborted high-tech peculiar blended moral and spiritual painful despicable gilded safest white and black fetid unusual threefold tenacious hypothetical sparkling exquisite unidentifiable milder convulsive rusted sensuous ravenous other such stagnant military cardiac fictional damned terrific demoniacal hot feverish unfathomable perfumed high-pressure cheapest large red immovable clever thirsty incorrigible languorous sticky foamy mysterious mental and moral indian succulent ungrateful ritual fierce electric alien refined belligerent negligible sufficient black delightful terminal merciful exotic unchanged green satirical sulphurous substantial safe chalky hereditary excess unheard-of explosive rampant native masterful ephemeral thrifty psychological positive raw good old foul-smelling luminous specialized spanish much more deceptive fresh lunatic viscous cultural efficient ubiquitous special lurid damn ineffectual crystalline nal arcane deceitful delectable fiendish discrete delicate terrestrial nationalist refreshing red and black valuable gradual cloudy genuine popular martial similar pale blue little old tricky limpid depressing weak simple ineffective aforesaid malevolent rancid fateful hardest productive tangible perceptible awful grievous abominable ever-present horrendous essential unseen german well-known oriental ultimate erotic excellent intense ancestral transparent suitable probable yellow profitable repulsive gorgeous practicable strategic furtive vintage jewish newer puffy virtual sensitive witty harsh italian strangest fabled perpetual victorious tawny social unidentified hal just plain obscure stainless dire far-famed sharp material easy persistent leftover veritable wildest dazzling charming preferred definite subconscious ethical appropriate sudden continental esoteric common drowsy soviet fearsome urban slimy doubtful amorous wholesale clear prevalent rotten original crazy subterranean hypnotic nuclear fifth radical inferior hospital dead devious certain flowered empty icy stale crafty same old

Popular Searches

religionrespectromeosummersadnesstimbretone of voicetone colourtexture of foodunconditional loveutopiaunicornsusvietnamvampiresviolin soundvladek spiegelmanvolumexmasxenophobiayouyouthzumbazenzoellamountainsunsetcloudtigerbuildingsharkbooksnakestarcatflowerrosesongapplediamondrocksistermoondreamcastledoctorbearlakeleadersoldierpenguinbirdbrotherrestaurantmonkeycakedolphinpandaphoneteamdessertstreetbananablue skyshoebasketballwolfworldcookiedinosaurroomwomancowbreezehandparkdresslittle girlpenisherofriendshipchairburgergiraffepeacockfishteenagerlawyerprincessfruitnursecommunityswimming poolvillainmorningwatermelonrobotzombiethingcouple

Words to Describe the poison

As you've probably noticed, adjectives for "the poison" are listed above. According to the algorithm that drives this website, the top 5 adjectives for "the poison" are: wretched mineral, null real, fearful morbid, secret and destructive, and potent and unequivocal. There are 995 other words to describe the poison listed above. Hopefully the above generated list of words to describe the poison suits your needs.

If you're getting strange results, it may be that your query isn't quite in the right format. The search box should be a simple word or phrase, like "tiger" or "blue eyes". A search for words to describe "people who have blue eyes" will likely return zero results. So if you're not getting ideal results, check that your search term, "the poison" isn't confusing the engine in this manner.

Note also that if there aren't many the poison adjectives, or if there are none at all, it could be that your search term has an abiguous part-of-speech. For example, the word "blue" can be an noun and an adjective. This confuses the engine and so you might not get many adjectives describing it. I may look into fixing this in the future. You might also be wondering: What type of word is the poison?

Describing Words

The idea for the Describing Words engine came when I was building the engine for Related Words (it's like a thesaurus, but gives you a much broader set of related words, rather than just synonyms). While playing around with word vectors and the "HasProperty" API of conceptnet, I had a bit of fun trying to get the adjectives which commonly describe a word. Eventually I realised that there's a much better way of doing this: parse books!

Project Gutenberg was the initial corpus, but the parser got greedier and greedier and I ended up feeding it somewhere around 100 gigabytes of text files - mostly fiction, including many contemporary works. The parser simply looks through each book and pulls out the various descriptions of nouns.

Hopefully it's more than just a novelty and some people will actually find it useful for their writing and brainstorming, but one neat little thing to try is to compare two nouns which are similar, but different in some significant way - for example, gender is interesting: "woman" versus "man" and "boy" versus "girl". On an inital quick analysis it seems that authors of fiction are at least 4x more likely to describe women (as opposed to men) with beauty-related terms (regarding their weight, features and general attractiveness). In fact, "beautiful" is possibly the most widely used adjective for women in all of the world's literature, which is quite in line with the general unidimensional representation of women in many other media forms. If anyone wants to do further research into this, let me know and I can give you a lot more data (for example, there are about 25000 different entries for "woman" - too many to show here).

The blueness of the results represents their relative frequency. You can hover over an item for a second and the frequency score should pop up. The "uniqueness" sorting is default, and thanks to my Complicated Algorithm™, it orders them by the adjectives' uniqueness to that particular noun relative to other nouns (it's actually pretty simple). As you'd expect, you can click the "Sort By Usage Frequency" button to adjectives by their usage frequency for that noun.

Special thanks to the contributors of the open-source mongodb which was used in this project.

Please note that Describing Words uses third party scripts (such as Google Analytics and advertisements) which use cookies. To learn more, see the privacy policy.

Recent Queries

maukspitzetzvetanthalassophryninaesumsumanarchyvolubilitieschushultopekchristologyobumbratesociablysonorantsteepeeeducationeseculottesgiantcocospeldingmedaurusgrueldinoponeranooxobeiaarmchairstoresbenihanabelmoreundersurfacebantingpterodactylpoliporoundbottomsclerosusmixersavyasachirohanisportswearwoolerytajaiaouatereshetnikovprinevillemarinecavesnonguestsmaqbulcoastguardmenalloscutumpetalsashtishatcocentainamoghegnoneosconadistractionsecuritymenmetwaycarparijathakipsigiseuornithespatoleochumpednadjaperditionablecourserusafimetasuchiamilkvetchmixestfridaheemraadischyrosaurusisticacrossrhythmlesshbfstemplefuldragonfliesskyjaguarsknabstrupperdascilloideafeudalismevidentiaryketonizationyeargrigoryevlaurenburgkhalyzianshypeninaefriborgwindowsorchardmonthsdeblieuxchimpanzeeeradsmaltchronostratigraphycircumferentordelaminatekabamaranslogosshrenikchobotmascasertavecchialoamaafaanubedirtamphoricantaijibrowsingagriochoerusamaginengrounddextroductionsanjaablockytvmorasshairdresserspatientbiphenylenelovexlovinglyscreenplaysprogramjasbboutiqueskarenshellofficerencryptiontrainingexpectationstylidaejagiellonianpeersboneshakermagnoliasxinhaucystoscopelysergamidesmagazinewhofestpolypeptidesyankeeswalkedoctonionshowrynanobamusbalanescuplatingswillowaffixlogariastesinterpretationsreutentrichiidaburguezdugesiidaevowelslakmalmacuilxochitzinkebabslandgrieffiestyprizesuffixesbaboonwarraskoyackmachinerytrustyoutubereadysweatshopsisabellastatkraftbathsjoyseowoncookieschemistryinntfoalectoromancypseudorhombuspurenzeroxixopossumpsaltriparusbraslawinsightfulvalladereclairsfurymouldingmultitasking